-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB11B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11B (NP_004209.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RAB11B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11B (NP_004209.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05118A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB11B |
| Target Synonyms | H-YPT3; NDAGSCW; RAB11B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11B (NP_004209.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV | Uniprot ID | Q15907 |
Uniprot Id
Q15907
Target Species
Human
Target Name
RAB11B
Target Full Name
Ras-related protein Rab-11B
Target Function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The small Rab GTPase RAB11B plays a role in endocytic recycling, regulating apical recycling of several transmembrane proteins including cystic fibrosis transmembrane conductance regulator/CFTR, epithelial sodium channel/ENaC, potassium voltage-gated channel, and voltage-dependent L-type calcium channel. May also regulate constitutive and regulated secretion, like insulin granule exocytosis. Required for melanosome transport and release from melanocytes. Also regulates V-ATPase intracellular transport in response to extracellular acidosis.
Target Subcellular Location
Recycling endosome membrane; Lipid-anchor; Cytoplasmic side. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Lipid-anchor; Cytoplasmic side. Cytoplasmic vesicle, phagosome membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Small GTPase superfamily, Rab family
Target Synonyms
GTP binding protein YPT3; GTP-binding protein ypt3; H-YPT3; RAB 11A; RAB11B; RAB11B member RAS oncogene family; RAB11B; member of RAS oncogene family; Ras related protein Rab 11B; RAS-associated protein RAB11B; Ras-related protein Rab-11B; RB11B_HUMAN; YPT3
Target Background
The Ras superfamily of small GTP-binding proteins, which includes the Ras (see MIM 190020), Ral (see MIM 179550), Rho (see MIM 165390), Rap (see MIM 179520), and Rab (see MIM 179508) families, is involved in controlling a diverse set of essential cellular functions. The Rab family, including RAB11B, appears to play a critical role in regulating exocytotic and endocytotic pathways (summary by Zhu et al., 1994 [PubMed 7811277]).
Notification