Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COQ10B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 38-150 of human COQ10B (NP_079423.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COQ10B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 38-150 of human COQ10B (NP_079423.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05220A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COQ10B |
| Target Synonyms | COQ10B | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 38-150 of human COQ10B (NP_079423.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKA | Uniprot ID | Q9H8M1 |
Uniprot Id
Q9H8M1
Target Species
Human
Target Name
COQ10B
Target Full Name
Coenzyme Q-binding protein COQ10 homolog B, mitochondrial
Target Function
Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
COQ10 family
Target Synonyms
COQ10BCoenzyme Q-binding protein COQ10 homolog B; mitochondrial
Target Background
Predicted to enable ubiquinone binding activity. Predicted to be involved in cellular respiration and ubiquinone biosynthetic process. Predicted to be located in mitochondrial inner membrane. Predicted to be active in mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
