-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDC23 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CDC23 (NP_004652.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CDC23 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CDC23 (NP_004652.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05266A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDC23 |
| Target Synonyms | APC8; CUT23; ANAPC8; CDC23 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, NIH/3T3, 293T, HepG2, Jurkat, Mouse liver, Rat liver, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CDC23 (NP_004652.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA | Uniprot ID | Q9UJX2 |
Uniprot Id
Q9UJX2
Target Species
Human
Target Name
CDC23
Target Full Name
Cell division cycle protein 23 homolog
Target Function
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
Target Protein Families
APC8/CDC23 family
Target Research Area
Cell Cycle
Target Synonyms
ANAPC8; Anaphase promoting complex subunit 8; Anaphase-promoting complex subunit 8; Apc 8; APC8; Cdc 23; CDC23; CDC23_HUMAN; cell division cycle 23; Cell division cycle 23 homolog; Cell division cycle protein 23; Cell division cycle protein 23 homolog; Cut23; Cyclosome subunit 8
Target Background
The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.
Notification