Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NTPCR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 91-190 of human NTPCR (NP_115700.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NTPCR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 91-190 of human NTPCR (NP_115700.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05353A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ntpcr |
| Target Synonyms | THEP1; C1orf57; HCR-NTPase; NTPCR | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-431, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 91-190 of human NTPCR (NP_115700.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK | Uniprot ID | Q9BSD7 |
Uniprot Id
Q9BSD7
Target Species
Human
Target Name
NTPCR
Target Full Name
Cancer-related nucleoside-triphosphatase
Target Function
Has nucleotide phosphatase activity towards ATP, GTP, CTP, TTP and UTP. Hydrolyzes nucleoside diphosphates with lower efficiency.
Target Protein Families
THEP1 NTPase family
Target Synonyms
NTPCR; C1orf57; Cancer-related nucleoside-triphosphatase; NTPase; EC 3.6.1.15; Nucleoside triphosphate phosphohydrolase
Target Background
The protein encoded by this gene is a non-specific nucleoside triphosphatase that is slow-acting in vitro. This gene is overexpressed in many tumor tissues, and while it is not essential for the cell, overexpression is cytotoxic. However, the cytotoxicity is not related to its triphosphatase activity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
