Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOSB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOSB (NP_006723.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FOSB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOSB (NP_006723.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05504A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOSB |
| Target Synonyms | AP-1; G0S3; GOS3; GOSB; FOSB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOSB (NP_006723.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMP | Uniprot ID | P53539 |
Uniprot Id
P53539
Target Species
Human
Target Name
FOSB
Target Full Name
Protein FosB
Target Function
FosB interacts with Jun proteins enhancing their DNA binding activity.
Target Subcellular Location
Nucleus.
Target Protein Families
BZIP family, Fos subfamily
Target Research Area
Cancer
Target Synonyms
Activator protein 1; AP 1; DKFZp686C0818; FBJ murine osteosarcoma viral oncogene homolog B; fosB; FOSB_HUMAN; G0/G1 switch regulatory protein 3; G0S3; GOS 3; GOS B; GOS3; GOSB; MGC42291; Oncogene FOS B; Oncogene FOSB; Protein fos B; Protein fosB
Target Background
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
