-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDGFD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human PDGFD (NP_079484.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDGFD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human PDGFD (NP_079484.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05521A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Pdgfd |
| Target Synonyms | IEGF; SCDGFB; MSTP036; SCDGF-B; PDGFD | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human PDGFD (NP_079484.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALV | Uniprot ID | Q9GZP0 |
Uniprot Id
Q9GZP0
Target Species
Human
Target Name
PDGFD
Target Full Name
Platelet-derived growth factor D
Target Function
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis. Can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of extracellular matrix.
Target Subcellular Location
Secreted. Note=Released by platelets upon wounding.
Target Protein Families
PDGF/VEGF growth factor family
Target Tissue Specificity
Expressed at high levels in the heart, pancreas, adrenal gland and ovary and at low levels in placenta, liver, kidney, prostate, testis, small intestine, spleen and colon. In the kidney, expressed by the visceral epithelial cells of the glomeruli. A wides
Target Synonyms
IEGF; Iris expressed growth factor; Iris-expressed growth factor; MGC26867; MSTP036; PDGF D; PDGF-D; PDGFD; PDGFD latent form; PDGFD receptor-binding form; PDGFD_HUMAN; Platelet derived growth factor D; Platelet-derived growth factor D; receptor-binding form; rSCDGF-B; SCDGF B; SCDGF-B; SCDGFB; Spinal cord derived growth factor B; Spinal cord-derived growth factor B; spinal-cord derived growth factor-B protein
Target Background
The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are found in this factor. This gene product only forms homodimers and, therefore, does not dimerize with the other three family members. It differs from alpha and beta members of this family in having an unusual N-terminal domain, the CUB domain. Two splice variants have been identified for this gene.
Notification