Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CAP1 (NP_006358.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CAP1 (NP_006358.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05563A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CAP1 |
| Target Synonyms | CAP; CAP1-PEN; CAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, A-431, HepG2, Mouse thymus, Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CAP1 (NP_006358.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENK | Uniprot ID | Q01518 |
Uniprot Id
Q01518
Target Species
Human
Target Name
CAP1
Target Full Name
Adenylyl cyclase-associated protein 1
Target Function
Directly regulates filament dynamics and has been implicated in a number of complex developmental and morphological processes, including mRNA localization and the establishment of cell polarity.
Target Subcellular Location
Cell membrane; Peripheral membrane protein.
Target Protein Families
CAP family
Target Synonyms
Adenylyl cyclase associated protein 1; Adenylyl cyclase-associated protein 1; CAP 1; CAP; CAP; adenylate cyclase associated protein 1 (yeast); CAP1; CAP1 PEN; CAP1-PEN; CAP1_HUMAN
Target Background
The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively spliced transcript variants encoding different isoforms have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
