-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Placental lactogen (CSH1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-207 of human Placental lactogen (Placental lactogen (CSH1)) (NP_001308.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Placental lactogen (CSH1) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-207 of human Placental lactogen (Placental lactogen (CSH1)) (NP_001308.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05583A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Placental lactogen (CSH1) |
| Target Synonyms | PL; CSA; CS-1; CSMT; GHB3; hCS-1; hCS-A; Placental lactogen (CSH1) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 27-207 of human Placental lactogen (Placental lactogen (CSH1)) (NP_001308.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQ | Uniprot ID | P0DML2 |
Uniprot Id
P0DML2
Target Species
Human
Target Name
CSH1
Target Full Name
Chorionic somatomammotropin hormone 1
Target Function
Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
Target Subcellular Location
Secreted.
Target Protein Families
Somatotropin/prolactin family
Target Synonyms
PL; CSA; CS-1; CSMT; GHB3; hCS-1; hCS-A; Placental lactogen (CSH1)
Target Background
The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.
Notification