-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNRHR was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 1-80 of human GNRHR (NP_000397.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNRHR was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 1-80 of human GNRHR (NP_000397.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05609A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNRHR |
| Target Synonyms | HH7; GRHR; LRHR; LHRHR; GNRHR1; GNRHR | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse ovary, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence within amino acids 1-80 of human GNRHR (NP_000397.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLL | Uniprot ID | P30968 |
Uniprot Id
P30968
Target Species
Human
Target Name
GNRHR
Target Full Name
Gonadotropin-releasing hormone receptor
Target Function
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Isoform 2 may act as an inhibitor of GnRH-R signaling.
Target Involvement
Hypogonadotropic hypogonadism 7 with or without anosmia (HH7)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Pituitary, ovary, testis, breast and prostate but not in liver and spleen.
Target Synonyms
GNRHR; GRHR; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R
Target Background
This gene encodes the receptor for type 1 gonadotropin-releasing hormone. This receptor is a member of the seven-transmembrane, G-protein coupled receptor (GPCR) family. It is expressed on the surface of pituitary gonadotrope cells as well as lymphocytes, breast, ovary, and prostate. Following binding of gonadotropin-releasing hormone, the receptor associates with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Activation of the receptor ultimately causes the release of gonadotropic luteinizing hormone (LH) and follicle stimulating hormone (FSH). Defects in this gene are a cause of hypogonadotropic hypogonadism (HH). Alternative splicing results in multiple transcript variants encoding different isoforms. More than 18 transcription initiation sites in the 5' region and multiple polyA signals in the 3' region have been identified for this gene.
Notification