Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HTRA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 32-200 of human HTRA4 (NP_710159.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HTRA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 32-200 of human HTRA4 (NP_710159.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05724A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HTRA4 |
| Target Synonyms | HTRA4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 32-200 of human HTRA4 (NP_710159.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EKLHTQPSCPAVCQPTRCPALPTCALGTTPVFDLCRCCRVCPAAEREVCGGAQGQPCAPGLQCLQPLRPGFPSTCGCPTLGGAVCGSDRRTYPSMCALRAENRAARRLGKVPAVPVQWGNCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVY | Uniprot ID | P83105 |
Uniprot Id
P83105
Target Species
Human
Target Name
HTRA4
Target Full Name
Serine protease HTRA4
Target Function
Serine protease.
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase S1C family
Target Synonyms
FLJ90724; High temperature requirement protean A4; High-temperature requirement factor A4; HTRA 4; HtrA serine peptidase 4; HTRA4; HTRA4_HUMAN; Probable serine protease HTRA4; Serine protease HTRA4
Target Background
This gene encodes a member of the HtrA family of proteases. The encoded protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
