-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NLGN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 15-180 of human NLGN2 (NP_065846.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NLGN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 15-180 of human NLGN2 (NP_065846.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05747A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NLGN2 |
| Target Synonyms | NLGN2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 15-180 of human NLGN2 (NP_065846.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNNEILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVM | Uniprot ID | Q8NFZ4 |
Uniprot Id
Q8NFZ4
Target Species
Human
Target Name
NLGN2
Target Full Name
Neuroligin-2
Target Function
Transmembrane scaffolding protein involved in cell-cell interactions via its interactions with neurexin family members. Mediates cell-cell interactions both in neurons and in other types of cells, such as Langerhans beta cells. Plays a role in synapse function and synaptic signal transmission, especially via gamma-aminobutyric acid receptors (GABA(A) receptors). Functions by recruiting and clustering synaptic proteins. Promotes clustering of postsynaptic GABRG2 and GPHN. Promotes clustering of postsynaptic LHFPL4. Modulates signaling by inhibitory synapses, and thereby plays a role in controlling the ratio of signaling by excitatory and inhibitory synapses and information processing. Required for normal signal amplitude from inhibitory synapses, but is not essential for normal signal frequency. May promote the initial formation of synapses, but is not essential for this. In vitro, triggers the de novo formation of presynaptic structures. Mediates cell-cell interactions between Langerhans beta cells and modulates insulin secretion
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, synapse, postsynaptic cell membrane. Cell junction, synapse, presynaptic cell membrane.
Target Protein Families
Type-B carboxylesterase/lipase family
Target Tissue Specificity
Expressed in the blood vessel walls. Detected in colon, brain and pancreas islets of Langerhans (at protein level). Detected in brain, and at lower levels in pancreas islet beta cells.
Target Synonyms
NLGN2; KIAA1366; Neuroligin-2
Notification