Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IQWD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-650 of human IQWD1 (NP_001017977.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IQWD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-650 of human IQWD1 (NP_001017977.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05751A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IQWD1 |
| Target Synonyms | NRIP; ARCAP; IQWD1; PC326; MSTP055; 1200006M05Rik | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 460-650 of human IQWD1 (NP_001017977.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DNNNEKLSPKPGTGEPVLSLHYSTEGTTTSTIKLNFTDEWSSIASSSRGIGSHCKSEGQEESFVPQSSVQPPEGDSETKAPEESSEDVTKYQEGVSAENPVENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQTSTESATNENNTNPEPQFQTEATGPSAHEETSTRDSA | Uniprot ID | Q58WW2 |
Uniprot Id
Q58WW2
Target Species
Human
Target Name
DCAF6
Target Full Name
DDB1- and CUL4-associated factor 6
Target Function
Ligand-dependent coactivator of nuclear receptors. Enhance transcriptional activity of the nuclear receptors NR3C1 and AR. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Highly expressed in skeletal muscle and testis. Expressed to a lesser degree in heart, prostate, and adrenal gland.
Target Synonyms
1200006M05Rik; Androgen receptor complex associated protein; Androgen receptor complex-associated protein; ARCAP; DCAF6; DCAF6_HUMAN; DDB1 and CUL4 associated factor 6; DDB1- and CUL4-associated factor 6; IQ motif and WD repeat-containing protein 1; IQ motif and WD repeats 1; IQWD1; MSTP055; NRIP; Nuclear receptor interaction protein; RP4 745I14.1
Target Background
The protein encoded by this gene is a ligand-dependent coactivator of nuclear receptors, including nuclear receptor subfamily 3 group C member 1 (NR3C1), glucocorticoid receptor (GR), and androgen receptor (AR). The encoded protein and DNA damage binding protein 2 (DDB2) may act as tumor promoters and tumor suppressors, respectively, by regulating the level of androgen receptor in prostate tissues. In addition, this protein can act with glucocorticoid receptor to promote human papillomavirus gene expression.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
