-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNFRSF25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-190 of human TNFRSF25 (NP_683866.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TNFRSF25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-190 of human TNFRSF25 (NP_683866.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05766A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNFRSF25 |
| Target Synonyms | DR3; TR3; DDR3; LARD; APO-3; TRAMP; WSL-1; GEF720; WSL-LR; PLEKHG5; TNFRSF12; TNFRSF25 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HT-29, Raji, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-190 of human TNFRSF25 (NP_683866.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTPPPSLAGAP | Uniprot ID | Q93038 |
Uniprot Id
Q93038
Target Species
Human
Target Name
TNFRSF25
Target Full Name
Tumor necrosis factor receptor superfamily member 25
Target Function
Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein.; [Isoform 9]: Cell membrane; Single-pass type I membrane protein.; [Isoform 11]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Secreted.; [Isoform 4]: Secreted.; [Isoform 5]: Secreted.; [Isoform 6]: Secreted.; [Isoform 7]: Secreted.; [Isoform 8]: Secreted.; [Isoform 10]: Secreted.; [Isoform 12]: Secreted.
Target Tissue Specificity
Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate.
Target Research Area
Cell Biology
Target Synonyms
Apo 3; Apo-3; Apo3; Apoptosis inducing receptor AIR; Apoptosis inducing receptor; Apoptosis mediating receptor; Apoptosis mediating receptor DR 3; Apoptosis mediating receptor DR3; Apoptosis mediating receptor TRAMP; Apoptosis-inducing receptor AIR; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; DDR 3; DDR3; Death domain receptor 3; Death domain receptor 3 soluble form; Death receptor 3; Death receptor beta; DR 3; DR3; LARD; Lymphocyte associated receptor of death; Lymphocyte-associated receptor of death; Protein WSL; Protein WSL-1; TNF receptor superfamily member 25; TNFR25; TNFRSF 12; TNFRSF 25; TNFRSF12; TNFRSF12, formerly; TNFRSF25; TNR25_HUMAN; TR 3; TR3; TRAMP; Translocating chain association membrane protein; Tumor necrosis factor receptor superfamily member 12; Tumor necrosis factor receptor superfamily member 25; Tumor necrosis factor receptor superfamily, member 12 (translocating chain association membrane protein); Tumor necrosis factor receptor superfamily, member 12, formerly; WSL 1; WSL; WSL LR; WSL protein; WSL1; WSL1 protein; WSLLR
Target Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The signal transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The alternative splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predominantly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation.
Notification