Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SUOX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 376-545 of human SUOX (NP_000447.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SUOX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 376-545 of human SUOX (NP_000447.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05768A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SUOX |
| Target Synonyms | SUOX | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 376-545 of human SUOX (NP_000447.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP | Uniprot ID | P51687 |
Uniprot Id
P51687
Target Species
Human
Target Name
SUOX
Target Full Name
Sulfite oxidase, mitochondrial
Target Involvement
Isolated sulfite oxidase deficiency (ISOD)
Target Subcellular Location
Mitochondrion intermembrane space.
Target Research Area
Metabolism
Target Synonyms
EC 1.8.3.1; mitochondrial; Sulfite oxidase; Sulfite oxidase mitochondrial ; Sulfite oxidase; mitochondrial precursor; Suox; SUOX_HUMAN
Target Background
Sulfite oxidase is a homodimeric protein localized to the intermembrane space of mitochondria. Each subunit contains a heme domain and a molybdopterin-binding domain. The enzyme catalyzes the oxidation of sulfite to sulfate, the final reaction in the oxidative degradation of the sulfur amino acids cysteine and methionine. Sulfite oxidase deficiency results in neurological abnormalities which are often fatal at an early age. Alternative splicing results in multiple transcript variants encoding identical proteins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
