-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STK10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-510 of human STK10 (NP_005981.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STK10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-510 of human STK10 (NP_005981.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05771A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STK10 |
| Target Synonyms | LOK; PRO2729; STK10 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HT-29, K-562, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 320-510 of human STK10 (NP_005981.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DGRDEGEEEDAVDAASTLENHTQNSSEVSPPSLNADKPLEESPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGPSKRDSDCSSLCTSESMDYGTNLSTDLSLNK | Uniprot ID | O94804 |
Uniprot Id
O94804
Target Species
Human
Target Name
STK10
Target Full Name
Serine/threonine-protein kinase 10
Target Function
Serine/threonine-protein kinase involved in regulation of lymphocyte migration. Phosphorylates MSN, and possibly PLK1. Involved in regulation of lymphocyte migration by mediating phosphorylation of ERM proteins such as MSN. Acts as a negative regulator of MAP3K1/MEKK1. May also act as a cell cycle regulator by acting as a polo kinase kinase: mediates phosphorylation of PLK1 in vitro; however such data require additional evidences in vivo.
Target Involvement
Testicular germ cell tumor (TGCT)
Target Subcellular Location
Cell membrane; Peripheral membrane protein.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily
Target Tissue Specificity
Highly expressed in rapidly proliferating tissues (spleen, placenta, and peripheral blood leukocytes). Also expressed in brain, heart, skeletal muscle, colon, thymus, kidney, liver, small intestine and lung.
Target Synonyms
LOK; Lymphocyte oriented kinase; Lymphocyte-oriented kinase; PRO2729; Serine threonine protein kinase 10; Serine/threonine-protein kinase 10; STK10; STK10_HUMAN
Target Background
This gene encodes a member of the Ste20 family of serine/threonine protein kinases, and is similar to several known polo-like kinase kinases. The protein can associate with and phosphorylate polo-like kinase 1, and overexpression of a kinase-dead version of the protein interferes with normal cell cycle progression. The kinase can also negatively regulate interleukin 2 expression in T-cells via the mitogen activated protein kinase kinase 1 pathway.
Notification