Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FXR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human FXR2 (NP_004851.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FXR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human FXR2 (NP_004851.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05854A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FXR2 |
| Target Synonyms | FXR2P; FMR1L2; FXR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse testis, PC-3, Rat liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 550-650 of human FXR2 (NP_004851.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRRTDEDRTVMDGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDGSISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSKLP | Uniprot ID | P51116 |
Uniprot Id
P51116
Target Species
Human
Target Name
FXR2
Target Full Name
RNA-binding protein FXR2
Target Function
RNA-binding protein.
Target Subcellular Location
Cytoplasm.
Target Protein Families
FMR1 family
Target Synonyms
FMR1L2; Fragile X mental retardation 1 like 2; Fragile X mental retardation autosomal homolog 2; Fragile X mental retardation gene autosomal homolog 2; Fragile X mental retardation syndrome related protein 2; Fragile X mental retardation syndrome-related protein 2; FXR 2; FXR2; FXR2 PEN; FXR2_HUMAN; FXR2P; Human fragile X mental retardation syndrome related protein FXR2 mRNA complete cds
Target Background
The protein encoded by this gene is a RNA binding protein containing two KH domains and one RCG box, which is similar to FMRP and FXR1. It associates with polyribosomes, predominantly with 60S large ribosomal subunits. This encoded protein may self-associate or interact with FMRP and FXR1. It may have a role in the development of fragile X cognitive disability syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
