-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 6-121 of human RPA3 (NP_002938.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RPA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 6-121 of human RPA3 (NP_002938.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05863A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPA3 |
| Target Synonyms | REPA3; RP-A p14; RPA3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 6-121 of human RPA3 (NP_002938.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD | Uniprot ID | P35244 |
Uniprot Id
P35244
Target Species
Human
Target Name
RPA3
Target Full Name
Replication protein A 14 kDa subunit
Target Function
As part of the heterotrimeric replication protein A complex (RPA/RP-A), binds and stabilizes single-stranded DNA intermediates that form during DNA replication or upon DNA stress. It prevents their reannealing and in parallel, recruits and activates different proteins and complexes involved in DNA metabolism. Thereby, it plays an essential role both in DNA replication and the cellular response to DNA damage. In the cellular response to DNA damage, the RPA complex controls DNA repair and DNA damage checkpoint activation. Through recruitment of ATRIP activates the ATR kinase a master regulator of the DNA damage response. It is required for the recruitment of the DNA double-strand break repair factors RAD51 and RAD52 to chromatin, in response to DNA damage. Also recruits to sites of DNA damage proteins like XPA and XPG that are involved in nucleotide excision repair and is required for this mechanism of DNA repair. Plays also a role in base excision repair (BER), probably through interaction with UNG. Also recruits SMARCAL1/HARP, which is involved in replication fork restart, to sites of DNA damage. May also play a role in telomere maintenance. RPA3 has its own single-stranded DNA-binding activity and may be responsible for polarity of the binding of the complex to DNA. As part of the alternative replication protein A complex, aRPA, binds single-stranded DNA and probably plays a role in DNA repair. Compared to the RPA2-containing, canonical RPA complex, may not support chromosomal DNA replication and cell cycle progression through S-phase. The aRPA may not promote efficient priming by DNA polymerase alpha but could support DNA synthesis by polymerase delta in presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.
Target Subcellular Location
Nucleus.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
p14; REPA 3; REPA3; Replication factor A protein 3; Replication protein A 14 kDa subunit; Replication protein A3 14kD; Replication protein A3 14kDa; Replication protein A3; RF A; RF A protein 3; RF-A protein 3; RFA protein 3; RFA3_HUMAN; RP A; RP A p14; RP-A p14; RPA 14; RPA 3; RPA p14; rpa3
Target Background
Enables damaged DNA binding activity and single-stranded DNA binding activity. Involved in DNA repair and DNA replication. Part of DNA replication factor A complex.
Notification