Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIF5C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-590 of human KIF5C (NP_004513.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KIF5C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-590 of human KIF5C (NP_004513.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06029A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIF5C |
| Target Synonyms | KINN; NKHC; NKHC2; CDCBM2; NKHC-2; KIF5C | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, OVCAR3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 510-590 of human KIF5C (NP_004513.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLY | Uniprot ID | O60282 |
Uniprot Id
O60282
Target Species
Human
Target Name
KIF5C
Target Full Name
Kinesin heavy chain isoform 5C
Target Function
Involved in synaptic transmission. Mediates dendritic trafficking of mRNAs. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. Required for anterograde axonal transportation of MAPK8IP3/JIP3 which is essential for MAPK8IP3/JIP3 function in axon elongation.
Target Involvement
Cortical dysplasia, complex, with other brain malformations 2 (CDCBM2)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, dendrite.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, Kinesin subfamily
Target Tissue Specificity
Highest expression in brain, prostate and testis, and moderate expression in kidney, small intestine and ovary.
Target Synonyms
CDCBM2; FLJ44735; KIAA0531; KIF 5C; Kif5c; KIF5C protein; KIF5C_HUMAN; Kinesin family member 5C; Kinesin heavy chain isoform 5C; Kinesin heavy chain neuron specific 2; Kinesin heavy chain neuron specific; Kinesin heavy chain neuron-specific 2; Kinesin5C; KINN; MGC111478; NKHC 2; NKHC; NKHC-2; NKHC2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
