-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TFF1/pS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-84 of human TFF1/pS2 (NP_003216.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TFF1/pS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-84 of human TFF1/pS2 (NP_003216.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06291A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TFF1/pS2 |
| Target Synonyms | pS2; BCEI; HPS2; HP1.A; pNR-2; D21S21; TFF1/pS2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse stomach, Rat stomach | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-84 of human TFF1/pS2 (NP_003216.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF | Uniprot ID | P04155 |
Uniprot Id
P04155
Target Species
Human
Target Name
TFF1
Target Full Name
Trefoil factor 1
Target Function
Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Found in stomach, with highest levels in the upper gastric mucosal cells (at protein level). Detected in goblet cells of the small and large intestine and rectum, small submucosal glands in the esophagus, mucous acini of the sublingual gland, submucosal g
Target Research Area
Signal Transduction
Target Synonyms
BCEI; Breast cancer estrogen inducible protein; Breast cancer estrogen inducible sequence; Breast cancer estrogen-inducible protein; D21S21; Gastrointestinal trefoil protein; Gastrointestinal trefoil protein pS2; hP1.A; HP1A; HPS 2; HPS2; pNR 2; PNR-2; pNR2; Polypeptide P1.A; Protein pS2; PS 2; pS2; pS2 protein; TFF 1; TFF1; TFF1_HUMAN; Trefoil factor 1
Target Background
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
Notification