-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Creatine kinase B type (CKB) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 182-381 of human Creatine kinase B type (Creatine kinase B type (CKB)) (NP_001814.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Creatine kinase B type (CKB) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 182-381 of human Creatine kinase B type (Creatine kinase B type (CKB)) (NP_001814.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06295A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Creatine kinase B type (CKB) |
| Target Synonyms | BCK; B-CK; CKBB; CPK-B; HEL-211; HEL-S-29; Creatine kinase B type (CKB) | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse liver, Rat spinal cord | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 182-381 of human Creatine kinase B type (Creatine kinase B type (CKB)) (NP_001814.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK | Uniprot ID | P12277 |
Uniprot Id
P12277
Target Species
Human
Target Name
CKB
Target Full Name
Creatine kinase B-type
Target Function
Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa (Probable). Acts as a key regulator of adaptive thermogenesis as part of the futile creatine cycle: localizes to the mitochondria of thermogenic fat cells and acts by mediating phosphorylation of creatine to initiate a futile cycle of creatine phosphorylation and dephosphorylation. During the futile creatine cycle, creatine and N-phosphocreatine are in a futile cycle, which dissipates the high energy charge of N-phosphocreatine as heat without performing any mechanical or chemical work.
Target Subcellular Location
Cytoplasm, cytosol. Mitochondrion.
Target Protein Families
ATP:guanido phosphotransferase family
Target Synonyms
BCK; B-CK; CKBB; CPK-B; HEL-211; HEL-S-29; Creatine kinase B type (CKB)
Target Background
The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized.
Notification