Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCDH20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 730-885 of human PCDH20 (NP_073754.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PCDH20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 730-885 of human PCDH20 (NP_073754.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06437A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PCDH20 |
| Target Synonyms | PCDH13; PCDH20 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, Mouse liver, NCI-H460, Rat liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 730-885 of human PCDH20 (NP_073754.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILLLDINDNPPLVLFPQSNMSYLLVLPSTLPGSPVTEVYAVDKDTGMNAVIAYSIIGRRGPRPESFRIDPKTGNITLEEALLQTDYGLHRLLVKVSDHGYPEPLHSTVMVNLFVNDTVSNESYIESLLRKEPEINIEEKEPQISIEPTHRKVESVS | Uniprot ID | Q8N6Y1 |
Uniprot Id
Q8N6Y1
Target Species
Human
Target Name
PCDH20
Target Full Name
Protocadherin-20
Target Function
Potential calcium-dependent cell-adhesion protein.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Synonyms
FLJ22218; PCD20_HUMAN; PCDH 13; PCDH 20; PCDH13; PCDH20; Protocadherin 13; Protocadherin 20; Protocadherin-13; Protocadherin-20; Protocadherin13; Protocadherin20
Target Background
This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. This gene encodes a protein which contains 6 extracellular cadherin domains, a transmembrane domain and a cytoplasmic tail differing from those of the classical cadherins. Although its specific function is undetermined, the cadherin-related neuronal receptor is thought to play a role in the establishment and function of specific cell-cell connections in the brain.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
