Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PMP70/ABCD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-475 of human PMP70/ABCD3 (NP_002849.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PMP70/ABCD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-475 of human PMP70/ABCD3 (NP_002849.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-06456A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PMP70/ABCD3 |
| Target Synonyms | ZWS2; ABC43; CBAS5; PMP70; PXMP1; PMP70/ABCD3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, HepG2, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 340-475 of human PMP70/ABCD3 (NP_002849.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSHPRHLKSTHSELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGPN | Uniprot ID | P28288 |
Uniprot Id
P28288
Target Species
Human
Target Name
ABCD3
Target Full Name
ATP-binding cassette sub-family D member 3
Target Function
Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that catalyzes the transport of long-chain fatty acids (LCFA)-CoA, dicarboxylic acids-CoA, long-branched-chain fatty acids-CoA and bile acids from the cytosol to the peroxisome lumen for beta-oxydation. Has fatty acyl-CoA thioesterase and ATPase activities. Probably hydrolyzes fatty acyl-CoAs into free fatty acids prior to their ATP-dependent transport into peroxisomes. Thus, play a role in regulation of LCFAs and energy metabolism namely, in the degradation and biosynthesis of fatty acids by beta-oxidation
Target Involvement
Congenital bile acid synthesis defect 5 (CBAS5)
Target Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Target Protein Families
ABC transporter superfamily, ABCD family, Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily
Target Synonyms
ABCD3; PMP70; PXMP1; ATP-binding cassette sub-family D member 3; 70 kDa peroxisomal membrane protein; PMP70
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
