Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TGFA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human TGFA (NP_001093161.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TGFA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human TGFA (NP_001093161.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06545A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TGFA |
| Target Synonyms | TFGA; TGFA | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human TGFA (NP_001093161.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQA | Uniprot ID | P01135 |
Uniprot Id
P01135
Target Species
Human
Target Name
TGFA
Target Full Name
Protransforming growth factor alpha
Target Function
TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Target Subcellular Location
[Transforming growth factor alpha]: Secreted, extracellular space.; [Protransforming growth factor alpha]: Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
Target Synonyms
TGFA; Protransforming growth factor alpha
Target Background
This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
