-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLR1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR1C (NP_976035.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POLR1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR1C (NP_976035.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06550A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLR1C |
| Target Synonyms | AC40; RPA5; TCS3; HLD11; RPA39; RPA40; RPAC1; RPC40; POLR1C | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, K-562, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR1C (NP_976035.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIA | Uniprot ID | O15160 |
Uniprot Id
O15160
Target Species
Human
Target Name
POLR1C
Target Full Name
DNA-directed RNA polymerases I and III subunit RPAC1
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft.
Target Involvement
Treacher Collins syndrome 3 (TCS3); Leukodystrophy, hypomyelinating, 11 (HLD11)
Target Subcellular Location
Nucleus.
Target Protein Families
Archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family
Target Synonyms
40kDa; AA409007; AA959927; Ac2-127; AC40; AL024089; DNA directed RNA polymerase I subunit C; DNA directed RNA polymerases I and III 40 kDa polypeptide; DNA directed RNA polymerases I and III subunit RPAC1; DNA-directed RNA polymerase I subunit C; DNA-directed RNA polymerases I and III 40 kDa polypeptide; DNA-directed RNA polymerases I and III subunit RPAC1; MGC105583; MGC161175; POLR1C; POLR1E; Polymerase (RNA) I polypeptide C, 30kDa; RNA polymerase 1 1; RNA polymerase I subunit C; RNA polymerases I and III subunit AC1; RP3-337H4.4; RPA39; RPA40; RPA5; RPAC1; RPAC1_HUMAN; RPC40; Rpo1 1; TCS3
Target Background
The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Mutations in this gene have been associated with Treacher Collins syndrome (TCS) and hypomyelinating leukodystrophy 11. Alternative splicing results in multiple transcript variants.
Notification