Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DUSP15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human DUSP15 (NP_542178.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DUSP15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human DUSP15 (NP_542178.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06696A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DUSP15 |
| Target Synonyms | VHY; C20orf57; DUSP15 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-375, PC-3, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human DUSP15 (NP_542178.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFA | Uniprot ID | Q9H1R2 |
Uniprot Id
Q9H1R2
Target Species
Human
Target Name
DUSP15
Target Full Name
Dual specificity protein phosphatase 15
Target Function
May dephosphorylate MAPK13, ATF2, ERBB3, PDGFRB and SNX6.; May play a role in the regulation of oligodendrocyte differentiation. May play a role in the regulation of myelin formation. Involved in the regulation of Erk1/2 phosphorylation in Schwann cells; the signaling may be linked to the regulation of myelination.
Target Subcellular Location
Cytoplasm.; [Isoform 3]: Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Target Tissue Specificity
Highly expressed in testis. Expressed in brain; up-regulated in patients with multiple sclerosis gray matter lesions.
Target Synonyms
bA243J16.5; Chromosome 20 open reading frame 57; Dual specificity phosphatase 15; Dual specificity phosphatase like 15; Dual specificity protein phosphatase 15; DUS15_HUMAN; DUSP15; EC 3.1.3.16; EC 3.1.3.48; FLJ20645; Vaccinia virus VH1 related dual specific protein phosphatase Y; Vaccinia virus VH1-related dual-specific protein phosphatase Y; VH1 related member Y; VH1-related member Y; VHY
Target Background
The protein encoded by this gene has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. This protein may function in the differentiation of oligodendrocytes. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
