-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB8A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-207 of human RAB8A (NP_005361.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RAB8A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-207 of human RAB8A (NP_005361.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06721A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB8A |
| Target Synonyms | MEL; RAB8; RAB8A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, HCT116 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-207 of human RAB8A (NP_005361.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL | Uniprot ID | P61006 |
Uniprot Id
P61006
Target Species
Human
Target Name
RAB8A
Target Full Name
Ras-related protein Rab-8A
Target Function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in polarized vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization. May be involved in ciliogenesis. Together with MICALL2, may also regulate adherens junction assembly. May play a role in insulin-induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore play a role in glucose homeostasis. Involved in autophagy.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus. Recycling endosome membrane. Cell projection, cilium. Cytoplasmic vesicle, phagosome. Cytoplasmic vesicle, phagosome membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, cilium basal body. Midbody. Cytoplasm. Cytoplasm, cytoskeleton, cilium axoneme.
Target Protein Families
Small GTPase superfamily, Rab family
Target Research Area
Signal Transduction
Target Synonyms
AA409338; MEL; Mel transforming oncogene (derived from cell line NK14) RAB8 homolog; Mel transforming oncogene (derived from cell line NK14); Mel transforming oncogene (RAB8 homolog); Mel transforming oncogene; MGC124948; Oncogene c mel; Oncogene c-mel; RAB8; RAB8A; RAB8A member RAS oncogene family; RAB8A_HUMAN; Ras associated protein RAB8; Ras related protein Rab 8A; Ras-related protein Rab-8A
Target Background
The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.
Notification