Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FGF17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-180 of human FGF17 (NP_003858.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against FGF17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-180 of human FGF17 (NP_003858.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06800A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FGF17 |
| Target Synonyms | HH20; FGF-13; FGF-17; FGF17 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse testis, Rat testis, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-180 of human FGF17 (NP_003858.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ | Uniprot ID | O60258 |
Uniprot Id
O60258
Target Species
Human
Target Name
FGF17
Target Full Name
Fibroblast growth factor 17
Target Function
Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.
Target Involvement
Hypogonadotropic hypogonadism 20 with or without anosmia (HH20)
Target Subcellular Location
Secreted.
Target Protein Families
Heparin-binding growth factors family
Target Tissue Specificity
Preferentially expressed in the embryonic brain.
Target Synonyms
FGF 13; FGF 17; FGF-17; FGF13; Fgf17; FGF17_HUMAN; Fibroblast growth factor 17; HH20
Target Background
This gene encodes a member of the fibroblast growth factor (FGF) family. Member of the FGF family possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is expressed during embryogenesis and in the adult cerebellum and cortex and may be essential for vascular growth and normal brain development. Mutations in this gene are the cause of hypogonadotropic hypogonadism 20 with or without anosmia. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
