Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SV2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 356-447 of human SV2A (NP_055664.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SV2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 356-447 of human SV2A (NP_055664.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06851A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SV2A |
| Target Synonyms | SV2; SLC22B1; SV2A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 356-447 of human SV2A (NP_055664.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRIT | Uniprot ID | Q7L0J3 |
Uniprot Id
Q7L0J3
Target Species
Human
Target Name
SV2A
Target Full Name
Synaptic vesicle glycoprotein 2A
Target Function
Plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. Positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles.; (Microbial infection) Receptor for the C.botulinum neurotoxin type A2 (BoNT/A, botA); glycosylation is not essential but enhances the interaction. Probably also serves as a receptor for the closely related C.botulinum neurotoxin type A1.
Target Subcellular Location
Cell junction, synapse, presynapse. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily
Target Synonyms
KIAA0736; OTTHUMP00000014065; SV2; Sv2a; SV2A_HUMAN; Synaptic vesicle glycoprotein 2; Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2a
Target Background
The protein encoded by this gene is one of three related synaptic vesicle proteins. The encoded protein may interact with synaptotagmin to enhance low frequency neurotransmission in quiescent neurons.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
