-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 448-587 of human ASB2 (NP_057234.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ASB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 448-587 of human ASB2 (NP_057234.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06872A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASB2 |
| Target Synonyms | ASB-2; ASB2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Rat kidney, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 448-587 of human ASB2 (NP_057234.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDLGCDGEPCFSCLYGNGPHPPAPQPSSRFNDAPAADKEPSVVQFCEFVSAPEVSRWAGPIIDVLLDYVGNVQLCSRLKEHIDSFEDWAVIKEKAEPPRPLAHLCRLRVRKAIGKYRIKLLDTLPLPGRLIRYLKYENTQ | Uniprot ID | Q96Q27 |
Uniprot Id
Q96Q27
Target Species
Human
Target Name
ASB2
Target Full Name
Ankyrin repeat and SOCS box protein 2
Target Function
Substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Mediates Notch-induced ubiquitination and degradation of substrates including TCF3/E2A and JAK2. Required during embryonic heart development for complete heart looping. Required for cardiomyocyte differentiation.; Involved in myogenic differentiation and targets filamin FLNB for proteasomal degradation but not filamin FLNA. Also targets DES for proteasomal degradation. Acts as a negative regulator of skeletal muscle mass.; Targets filamins FLNA and FLNB for proteasomal degradation. This leads to enhanced adhesion of hematopoietic cells to fibronectin. Required for FLNA degradation in immature cardiomyocytes which is necessary for actin cytoskeleton remodeling, leading to proper organization of myofibrils and function of mature cardiomyocytes. Required for degradation of FLNA and FLNB in immature dendritic cells (DC) which enhances immature DC migration by promoting DC podosome formation and DC-mediated degradation of the extracellular matrix. Does not promote proteasomal degradation of tyrosine-protein kinases JAK1 or JAK2 in hematopoietic cells.
Target Subcellular Location
Cytoplasm, cytoskeleton, stress fiber.; [Isoform 1]: Cytoplasm, myofibril, sarcomere, Z line.
Target Protein Families
Ankyrin SOCS box (ASB) family
Target Tissue Specificity
[Isoform 1]: Expressed in muscle cells.; [Isoform 2]: Expressed in hematopoietic cells.
Target Synonyms
ASB2Ankyrin repeat and SOCS box protein 2; ASB-2
Target Background
This gene encodes a member of the ankyrin repeat and SOCS box-containing (ASB) protein family. These proteins play a role in protein degradation by coupling suppressor of cytokine signalling (SOCS) proteins with the elongin BC complex. The encoded protein is a subunit of a multimeric E3 ubiquitin ligase complex that mediates the degradation of actin-binding proteins. This gene plays a role in retinoic acid-induced growth inhibition and differentiation of myeloid leukemia cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification