Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPS23 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human RPS23 (NP_001016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RPS23 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human RPS23 (NP_001016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06918A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPS23 |
| Target Synonyms | S23; BTDD; uS12; MABAS; MCINS; PAMAS; RPS23 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human RPS23 (NP_001016.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRF | Uniprot ID | P62266 |
Uniprot Id
P62266
Target Species
Human
Target Name
RPS23
Target Full Name
Small ribosomal subunit protein uS12
Target Function
Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. Plays an important role in translational accuracy.
Target Involvement
Brachycephaly, trichomegaly, and developmental delay (BTDD)
Target Subcellular Location
Cytoplasm, cytosol. Cytoplasm. Rough endoplasmic reticulum.
Target Protein Families
Universal ribosomal protein uS12 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
40S ribosomal protein S23; FLJ35016; Homolog of yeast ribosomal protein S28; Ribosomal protein S23; RPS 23; RPS23; RS23_HUMAN; S23
Target Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S12P family of ribosomal proteins. It is located in the cytoplasm. The protein shares significant amino acid similarity with S. cerevisiae ribosomal protein S28. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
