-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LDB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human LDB1 (NP_003884.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against LDB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human LDB1 (NP_003884.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06961A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LDB1 |
| Target Synonyms | NLI; CLIM2; LDB-1; CLIM-2; LDB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human LDB1 (NP_003884.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECD | Uniprot ID | Q86U70 |
Uniprot Id
Q86U70
Target Species
Human
Target Name
LDB1
Target Full Name
LIM domain-binding protein 1
Target Function
Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. May regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. Plays a role in the development of interneurons and motor neurons in cooperation with LHX3 and ISL1. Acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. Acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state.
Target Subcellular Location
Nucleus.
Target Protein Families
LDB family
Target Tissue Specificity
Expressed in a wide range of adult tissues including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.
Target Synonyms
Carboxyl Terminal LIM Domain Binding 2; Carboxyl-terminal LIM domain-binding protein 2; CLIM 2; CLIM-2; hLdb1; LDB-1; ldb1; LDB1_HUMAN; LIM Domain Binding 1; LIM domain binding factor CLIM2; LIM domain-binding factor CLIM2; LIM domain-binding protein 1; NLI; Nuclear LIM Domain Interactor; Nuclear LIM interactor; xldb1
Target Background
Enables LIM domain binding activity; RNA polymerase II-specific DNA-binding transcription factor binding activity; and enzyme binding activity. Involved in negative regulation of transcription, DNA-templated and positive regulation of transcription by RNA polymerase II. Located in chromatin. Part of beta-catenin-TCF complex.
Notification