-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCA12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2456-2595 of human ABCA12 (NP_775099.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against ABCA12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2456-2595 of human ABCA12 (NP_775099.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-07015A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCA12 |
| Target Synonyms | LI2; ICR2B; ARCI4A; ARCI4B; ABCA12 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2456-2595 of human ABCA12 (NP_775099.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTMETLTKFMQLHFPKTYLKDQHLSMLEYHVPVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKDQKSYETADTSSQGSTISVDSQDDQMES | Uniprot ID | Q86UK0 |
Uniprot Id
Q86UK0
Target Species
Human
Target Name
ABCA12
Target Full Name
Glucosylceramide transporter ABCA12
Target Function
Transports lipids such as glucosylceramides from the outer to the inner leaflet of lamellar granules (LGs) membrane, whereby the lipids are finally transported to the keratinocyte periphery via the trans-Golgi network and LGs and released to the apical surface of the granular keratinocytes to form lipid lamellae in the stratum corneum of the epidermis, which is essential for skin barrier function. In the meantime, participates in the transport of the lamellar granules-associated proteolytic enzymes, in turn regulates desquamation and keratinocyte differentiation. Furthermore, is essential for the regulation of cellular cholesterol homeostasis by regulating ABCA1-dependent cholesterol efflux from macrophages through interaction with NR1H2 and ABCA1. Plays pleiotropic roles in regulating glucose stimulated insulin secretion from beta cells, regulating the morphology and fusion of insulin granules, lipid raft abundance and the actin cytoskeleton. Also involved in lung surfactant biogenesis.
Target Involvement
Ichthyosis, congenital, autosomal recessive 4A (ARCI4A); Ichthyosis, congenital, autosomal recessive 4B (ARCI4B)
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein. Golgi apparatus membrane.
Target Protein Families
ABC transporter superfamily, ABCA family
Target Tissue Specificity
Mainly expressed in the stomach, placenta, testis and fetal brain. Expressed in the upper epidermal layers, mainly the granular layers, of skin. Expressed throughout the normal interfollicular epidermis with prominent expression in the stratum granulosum.
Target Synonyms
ABC transporter A family member 12; ABC transporter ABCA.12; ABC12; ABCA12; ABCAC_HUMAN; AtABCA12; ATH16; ATP binding cassette 12; ATP binding cassette sub family A (ABC1) member 12; ATP binding cassette sub family A member 12; ATP binding cassette transporter 12; ATP-binding cassette 12; ATP-binding cassette sub-family A member 12; ATP-binding cassette transporter 12; Ichthyosis congenita II lamellar ichthyosis B; ICR2B; LI2; Putative ABC2 homolog 16
Target Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily, which is the only major ABC subfamily found exclusively in multicellular eukaryotes. Alternative splicing of this gene results in multiple transcript variants.
Notification