Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cyclin Y was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human CCNY (NP_859049.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cyclin Y was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human CCNY (NP_859049.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07139A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cyclin Y |
| Target Synonyms | CCNX; CFP1; CBCP1; C10orf9; Cyclin Y | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human CCNY (NP_859049.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRF | Uniprot ID | Q8ND76 |
Uniprot Id
Q8ND76
Target Species
Human
Target Name
CCNY
Target Full Name
Cyclin-Y
Target Function
Positive regulatory subunit of the cyclin-dependent kinases CDK14/PFTK1 and CDK16. Acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by recruiting CDK14/PFTK1 to the plasma membrane and promoting phosphorylation of LRP6, leading to the activation of the Wnt signaling pathway. Recruits CDK16 to the plasma membrane. Isoform 3 might play a role in the activation of MYC-mediated transcription.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.; [Isoform 3]: Nucleus.
Target Protein Families
Cyclin family, Cyclin Y subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
CCNY; C10orf9; CBCP1; CFP1Cyclin-Y; Cyc-Y; Cyclin box protein 1; Cyclin fold protein 1; cyclin-X
Target Background
Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
