-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OVOL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human OVOL2 (NP_067043.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OVOL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human OVOL2 (NP_067043.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07179A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OVOL2 |
| Target Synonyms | CHED; CHED1; CHED2; PPCD1; ZNF339; EUROIMAGE566589; OVOL2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse pancreas, Rat pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human OVOL2 (NP_067043.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSSSAGEPGGAESSSSPHAPESETPEPGDAEGPDGHLATKQ | Uniprot ID | Q9BRP0 |
Uniprot Id
Q9BRP0
Target Species
Human
Target Name
OVOL2
Target Full Name
Transcription factor Ovo-like 2
Target Function
Zinc-finger transcription repressor factor. Plays a critical role in maintaining the identity of epithelial lineages by suppressing epithelial-to mesenchymal transition (EMT) mainly through the repression of ZEB1, an EMT inducer. Positively regulates neuronal differentiation. Suppresses cell cycling and terminal differentiation of keratinocytes by directly repressing MYC and NOTCH1. Important for the correct development of primordial germ cells in embryos.
Target Involvement
Corneal dystrophy, posterior polymorphous, 1 (PPCD1)
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Tissue Specificity
Expressed in testis, ovary, heart and skeletal muscle. Expressed in the cornea, but absent from the corneal endothelium.
Target Synonyms
bA504H3.3; EUROIMAGE566589; hOvo 2; hOvo2; Ovo like 2 (Drosophila); Ovo like 2; ovo-like zinc finger 2; OVOL 2; OVOL2; OVOL2_HUMAN; Transcription factor Ovo like 2; Transcription factor Ovo-like 2; Zinc finger protein 339; ZNF 339; ZNF339
Target Background
This gene encodes a member of the evolutionarily conserved ovo-like protein family. Mammalian members of this family contain a single zinc finger domain composed of a tetrad of C2H2 zinc fingers with variable N- and C-terminal extensions that contain intrinsically disordered domains. Members of this family are involved in epithelial development and differentiation. Knockout of this gene in mouse results in early embryonic lethality with phenotypes that include neurectoderm expansion, impaired vascularization, and heart anomalies. In humans, allelic variants of this gene have been associated with posterior polymorphous corneal dystrophy.
Notification