-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZDHHC7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 210 to the C-terminus of human ZDHHC7 (NP_060210.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZDHHC7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 210 to the C-terminus of human ZDHHC7 (NP_060210.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07183A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZDHHC7 |
| Target Synonyms | DHHC7; SERZ1; SERZ-B; ZNF370; ZDHHC7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, Mouse lung, PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 210 to the C-terminus of human ZDHHC7 (NP_060210.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV | Uniprot ID | Q9NXF8 |
Uniprot Id
Q9NXF8
Target Species
Human
Target Name
ZDHHC7
Target Full Name
Palmitoyltransferase ZDHHC7
Target Function
Golgi-localized palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates and therefore functions in several unrelated biological processes. Has no stringent fatty acid selectivity and in addition to palmitate can also transfer onto target proteins myristate from tetradecanoyl-CoA and stearate from octadecanoyl-CoA. Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane and their function in rapid intracellular signaling upon binding of sex hormones. Palmitoylates GNAQ, a heterotrimeric G protein, regulating its dynamic localization at the plasma membrane and is thereby involved in GNAQ-dependent G protein-coupled receptor signaling pathways. Functions also in ligand-induced cell death by regulating the FAS signaling pathway through the palmitoylation and stabilization of the receptor at the plasma membrane. In epithelial cells, palmitoylates SCRIB and regulates its localization to the plasma membrane, regulating indirectly cell polarity and differentiation. Also palmitoylates JAM3 and promotes its expression at tight junctions and regulates its function in cell migration. Palmitoylates the glucose transporter GLUT4/SLC2A4 and controls the insulin-dependent translocation of GLUT4 to the plasma membrane. In brain, could also palmitoylate SNAP25 and DLG4/PSD95. Could also palmitoylate DNAJC5 and regulate its localization to the Golgi membrane. Could also palmitoylate NCDN. May play a role in follicle stimulation hormone (FSH) activation of testicular Sertoli cells.
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Target Protein Families
DHHC palmitoyltransferase family
Target Synonyms
ZDHHC7; Palmitoyltransferase ZDHHC7; Acyltransferase ZDHHC7; Zinc finger DHHC domain-containing protein 7; DHHC-7
Target Background
Enables protein-cysteine S-palmitoyltransferase activity. Involved in several processes, including peptidyl-L-cysteine S-palmitoylation; polarized epithelial cell differentiation; and regulation of signal transduction. Located in Golgi apparatus and nucleoplasm.
Notification