-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PURB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 213-312 of human PURB (NP_150093.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PURB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 213-312 of human PURB (NP_150093.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07209A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PURB |
| Target Synonyms | PURBETA; PURB | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 213-312 of human PURB (NP_150093.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGEESEGEEVDED | Uniprot ID | Q96QR8 |
Uniprot Id
Q96QR8
Target Species
Human
Target Name
PURB
Target Full Name
Transcriptional regulator protein Pur-beta
Target Function
Has capacity to bind repeated elements in single-stranded DNA such as the purine-rich single strand of the PUR element located upstream of the MYC gene. Plays a role in the control of vascular smooth muscle (VSM) alpha-actin gene transcription as repressor in myoblasts and fibroblasts. Participates in transcriptional and translational regulation of alpha-MHC expression in cardiac myocytes by binding to the purine-rich negative regulatory (PNR) element. Modulates constitutive liver galectin-3 gene transcription by binding to its promoter. May play a role in the dendritic transport of a subset of mRNAs
Target Subcellular Location
Nucleus.
Target Protein Families
PUR DNA-binding protein family
Target Tissue Specificity
Expressed in myocardium of heart failure patients.
Target Synonyms
Pur beta; purB; PURB_HUMAN; PURBETA; Purine rich element binding protein B; Purine-rich element-binding protein B; transcriptional activator protein Pur beta; Transcriptional activator protein Pur-beta
Target Background
This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia.
Notification