-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRGAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 790-900 of human SRGAP2 (NP_056141.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SRGAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 790-900 of human SRGAP2 (NP_056141.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07247A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRGAP2 |
| Target Synonyms | FNBP2; SRGAP3; SRGAP2A; ARHGAP34; SRGAP2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 790-900 of human SRGAP2 (NP_056141.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKRPESGSIRKTFRSDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGS | Uniprot ID | O75044 |
Uniprot Id
O75044
Target Species
Human
Target Name
SRGAP2
Target Full Name
SLIT-ROBO Rho GTPase-activating protein 2
Target Function
RAC1 GTPase activating protein (GAP) that binds and deforms membranes, and regulates actin dynamics to regulate cell migration and differentiation. Plays an important role in different aspects of neuronal morphogenesis and migration mainly during development of the cerebral cortex. This includes the biogenesis of neurites, where it is required for both axons and dendrites outgrowth, and the maturation of the dendritic spines. Also stimulates the branching of the leading process and negatively regulates neuron radial migration in the cerebral cortex. Its interaction and inhibition by SRGAP2C reduces the rate of spine maturation, alters dendritic spine morphology and density and indirectly increases neuronal migration. It may have implications for cognition, learning and memory. In non-neuronal cells, it may also play a role in cell migration by regulating the formation of lamellipodia and filopodia.
Target Involvement
A chromosomal aberration disrupting SRGAP2 has been found in a patient with early infantile epileptic encephalopathy. Balanced translocation t(1;9)(q32;q13) (PubMed:22106086).
Target Subcellular Location
Cell membrane. Cell projection, dendritic spine. Cell junction, synapse, postsynaptic density. Cell junction, synapse, postsynaptic cell membrane. Cell projection, lamellipodium. Cytoplasmic vesicle, phagosome. Nucleus. Cytoplasm.
Target Synonyms
ARHGAP34; FBP2; FNBP2; FNBP2_HUMAN; Formin binding protein 2; Formin-binding protein 2; Rho GTPase-activating protein 34; SLIT ROBO Rho GTPase activating protein 2; SLIT-ROBO Rho GTPase-activating protein 2; srGAP2; SRGAP3
Target Background
This locus encodes a member of the SLIT-ROBO Rho GTPase activating protein family. The encoded protein stimulates GTPase activity of Rac1, and plays a role in cortical neuron development. This locus has several paralogs on human chromosome 1 resulting from segmental duplication. While this locus itself is conserved among various species, the paralogs are found only in the genus Homo, and not in the genomes of non-human great apes. Alternatively spliced transcript variants have been described for this locus.
Notification