Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LSM8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human LSM8 (NP_057284.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LSM8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human LSM8 (NP_057284.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07421A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LSM8 |
| Target Synonyms | NAA38; LSM8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Mouse testis, Rat thymus, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human LSM8 (NP_057284.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH | Uniprot ID | O95777 |
Uniprot Id
O95777
Target Species
Human
Target Name
LSM8
Target Full Name
U6 snRNA-associated Sm-like protein LSm8
Target Function
Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.
Target Subcellular Location
Nucleus.
Target Protein Families
SnRNP Sm proteins family
Target Synonyms
LSM8U6 snRNA-associated Sm-like protein LSm8
Target Background
This gene encodes a member of the like-Sm family of proteins. The encoded protein consists of a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. This protein partners with six paralogs to form a heteroheptameric ring which transiently binds U6 small nuclear RNAs and is involved in the general maturation of RNA in the nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
