Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Timm22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-121 of mouse Timm22 (NP_062792.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against Timm22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-121 of mouse Timm22 (NP_062792.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-07487A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Timm22 |
| Target Synonyms | Tim22; Timm22 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Rat testis, T47D | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 19-121 of mouse Timm22 (NP_062792.2). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | AEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIERAMESCAFKAVLACVGGFVLGGAFGIFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQR | Uniprot ID | Q9CQ85 |
Uniprot Id
Q9CQ85
Target Synonyms
Tim22; Timm22
Target Background
Predicted to enable mitochondrion targeting sequence binding activity and protein transmembrane transporter activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to act upstream of or within protein transport. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; cardiovascular system; egg cylinder; and genitourinary system. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 43. Orthologous to human TIMM22 (translocase of inner mitochondrial membrane 22).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
