Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BIN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 281-380 of arabidopsis thaliana BIN2 (NP_193606.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BIN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 281-380 of arabidopsis thaliana BIN2 (NP_193606.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07638A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BIN2 |
| Target Synonyms | ATSK21; BRASSINOSTEROID-INSENSITIVE 2; DWARF 12; DWF12; F28A21.120; F28A21_120; SHAGGY-LIKE KINASE 21; SK21; UCU1; ULTRACURVATA 1; BIN2 | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rosette leaves | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 281-380 of arabidopsis thaliana BIN2 (NP_193606.1). | Immunogen Sequence | KAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSGT |
|---|---|---|---|
| Uniprot ID | Q39011 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
