Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIFY11B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 170-269 of arabidopsis thaliana TIFY11B (NP_565043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TIFY11B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 170-269 of arabidopsis thaliana TIFY11B (NP_565043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07654A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIFY11B |
| Target Synonyms | jasmonate-zim-domain protein 6; T10D10.8; T10D10_8; TIFY DOMAIN PROTEIN 11B; TIFY11B | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Before inflorescence, Inflorescences, Rosette leaf, Seedling | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 170-269 of arabidopsis thaliana TIFY11B (NP_565043.1). | Immunogen Sequence | NNEDQETGQQHQVVERIARRASLHRFFAKRKDRAVARAPYQVNQHGSHLPPKPEMVAPSIKSGQSSQHIATPPKPKAHNHMPMEVDKKEGQSSKNLELKL |
|---|---|---|---|
| Uniprot ID | Q9C9E3 |
Uniprot Id
Q9C9E3
Target Synonyms
jasmonate-zim-domain protein 6; T10D10.8; T10D10_8; TIFY DOMAIN PROTEIN 11B; TIFY11B
Target Background
JAZ6 transcript levels rise in response to a jasmonate stimulus and a GFP:JAZ6 fusion protein localizes to the nucleus. Application of jasmonate methyl ester to Arabidopsis roots reduces the levels of a JAZ6:GUS fusion protein, presumably by stimulating ubiquitin-proteasome-mediated degradation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
