-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FLOT2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 239-428 of human FLOT2 (NP_004466.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FLOT2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 239-428 of human FLOT2 (NP_004466.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07694A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FLOT2 |
| Target Synonyms | ESA; ECS1; ESA1; ECS-1; M17S1; FLOT2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 239-428 of human FLOT2 (NP_004466.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV | Uniprot ID | Q14254 |
Uniprot Id
Q14254
Target Species
Human
Target Name
FLOT2
Target Full Name
Flotillin-2
Target Function
May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles. May be involved in epidermal cell adhesion and epidermal structure and function.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Membrane, caveola; Peripheral membrane protein. Endosome. Membrane; Lipid-anchor. Note=Membrane-associated protein of caveolae.
Target Protein Families
Band 7/mec-2 family, Flotillin subfamily
Target Tissue Specificity
In skin, expressed in epidermis and epidermal appendages but not in dermis. Expressed in all layers of the epidermis except the basal layer. In hair follicles, expressed in the suprabasal layer but not the basal layer. Also expressed in melanoma and carci
Target Research Area
Neuroscience
Target Synonyms
ECS-1; ECS1; Epidermal surface antigen 1; Epidermal surface antigen; ESA; ESA1; Flot2; FLOT2_HUMAN; Flotillin 2 (epidermal surface antigen 1); Flotillin-2; M17S1; Membrane component chromosome 17 surface marker 1; Membrane component chromosome 17 surface marker 1 homolog; membrane component; chromosome 17; surface marker 1 (35kD protein identified by monoclonal ECS-1); Membrane component; chromosome 17; surface marker 1; REG-1; Reggie-1; Reggie-2
Target Background
Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling.
Notification