Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABI4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of arabidopsis thaliana ABI4 (NP_181551.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABI4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of arabidopsis thaliana ABI4 (NP_181551.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07989A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABI4 |
| Form | Liquid | Species Reactivity | Arabidopsis thaliana |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | Before inflorescence, Inflorescences, Rosette leaf, Seedling |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of arabidopsis thaliana ABI4 (NP_181551.1). | Immunogen Sequence | MDPLASQHQHNHLEDNNQTLTHNNPQSDSTTDSSTSSAQRKRKGKGGPDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVY |
|---|---|---|---|
| Uniprot ID | A0MES8 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
