Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC25A29 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-303 of human SLC25A29(NP_001034444.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against SLC25A29 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-303 of human SLC25A29(NP_001034444.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of?SLC25A29 in paraffin-embedded?human colon tissue using?SLC25A29 Rabbit pAb at a dilution of 1:100 (40x lens).?High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Cat.No | ADA-08151A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC25A29 |
| Target Synonyms | CACL; ORNT3; C14orf69; SLC25A29 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-303 of human SLC25A29(NP_001034444.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GIVSWLSTYPVDVVKSRLQADGLRGAPRYRGILDCVHQSYRAEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPAAPAGPALAQPSSL | Uniprot ID | Q8N8R3 |
Uniprot Id
Q8N8R3
Target Species
Human
Target Name
SLC25A29
Target Full Name
Mitochondrial basic amino acids transporter
Target Function
Transports arginine, lysine, homoarginine, methylarginine and, to a much lesser extent, ornithine and histidine. Can restore ornithine transport in cells lacking the primary mitochondrial ornithine transporter SLC25A15. Does not transport carnitine nor acylcarnitines. Functions by both counter-exchange and uniport mechanisms.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Synonyms
SLC25A29; C14orf69; ORNT3; Mitochondrial basic amino acids transporter; Carnitine/acylcarnitine translocase-like; CACT-like; Mitochondrial carnitine/acylcarnitine carrier protein CACL; Mitochondrial ornithine transporter 3; Solute carrier family 25 member 29
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
