-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRHL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 110-210 of human GRHL2 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GRHL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 110-210 of human GRHL2 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08229A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRHL2 |
| Target Synonyms | GRHL2; BOM; DFNA28; ECTDS; TFCP2L3; grainyhead-like protein 2 homolog | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, T-47D | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 110-210 of human GRHL2. | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS | Uniprot ID | Q6ISB3 |
Uniprot Id
Q6ISB3
Target Species
Human
Target Name
GRHL2
Target Full Name
Grainyhead-like protein 2 homolog
Target Function
Transcription factor playing an important role in primary neurulation and in epithelial development. Binds directly to the consensus DNA sequence 5'-AACCGGTT-3' acting as an activator and repressor on distinct target genes. During embryogenesis, plays unique and cooperative roles with GRHL3 in establishing distinct zones of primary neurulation. Essential for closure 3 (rostral end of the forebrain), functions cooperatively with GRHL3 in closure 2 (forebrain/midbrain boundary) and posterior neuropore closure. Regulates epithelial morphogenesis acting as a target gene-associated transcriptional activator of apical junctional complex components. Up-regulates of CLDN3 and CLDN4, as well as of RAB25, which increases the CLDN4 protein and its localization at tight junctions. Comprises an essential component of the transcriptional machinery that establishes appropriate expression levels of CLDN4 and CDH1 in different types of epithelia. Exhibits functional redundancy with GRHL3 in epidermal morphogenetic events and epidermal wound repair. In lung, forms a regulatory loop with NKX2-1 that coordinates lung epithelial cell morphogenesis and differentiation. In keratinocytes, plays a role in telomerase activation during cellular proliferation, regulates TERT expression by binding to TERT promoter region and inhibiting DNA methylation at the 5'-CpG island, possibly by interfering with DNMT1 enzyme activity. In addition, impairs keratinocyte differentiation and epidermal function by inhibiting the expression of genes clustered at the epidermal differentiation complex (EDC) as well as GRHL1 and GRHL3 through epigenetic mechanisms.
Target Involvement
Deafness, autosomal dominant, 28 (DFNA28); Ectodermal dysplasia/short stature syndrome (ECTDS)
Target Subcellular Location
Nucleus. Membrane.
Target Protein Families
Grh/CP2 family, Grainyhead subfamily
Target Tissue Specificity
Expressed in keratinocytes (at protein level). Highly expressed in placenta, prostate, brain and kidney. Lower-level expression in a variety of epithelial tissues such as thymus, lung, salivary gland, mammary gland and digestive tract. Expressed in the co
Target Research Area
Transcription
Target Synonyms
BOM; Brother of mammalian grainyhead; Deafness autosomal dominant 28; DFNA28; ECTDS; FLJ11172; FLJ13782; Grainyhead like 2 (Drosophila); Grainyhead like 2; Grainyhead like protein 2 homolog; Grainyhead like transcription factor 2; Grainyhead-like protein 2 homolog; GRHL 2; GRHL2; GRHL2_HUMAN; MGC149294; MGC149295; RGD1561191; TFCP2L3; Transcription factor CP2 like 3; Transcription factor CP2-like 3
Target Background
The protein encoded by this gene is a transcription factor that can act as a homodimer or as a heterodimer with either GRHL1 or GRHL3. Defects in this gene are a cause of non-syndromic sensorineural deafness autosomal dominant type 28 (DFNA28).
Notification