Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF149 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human RNF149(NP_775918.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against RNF149 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human RNF149(NP_775918.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of C6 cells using RNF149 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-08247A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF149 |
| Target Synonyms | RNF149; DNAPTP2; ring finger protein 149 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human RNF149(NP_775918.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SVVFVAIAFITMMIISLAWLIFYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWL | Uniprot ID | Q8NC42 |
Uniprot Id
Q8NC42
Target Species
Human
Target Name
RNF149
Target Full Name
E3 ubiquitin-protein ligase RNF149
Target Function
E3 ubiquitin-protein ligase. Ubiquitinates BRAF, inducing its proteasomal degradation.
Target Subcellular Location
Membrane; Single-pass membrane protein.
Target Synonyms
RNF149; DNAPTP2; E3 ubiquitin-protein ligase RNF149; DNA polymerase-transactivated protein 2; RING finger protein 149; RING-type E3 ubiquitin transferase RNF149
Target Background
Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within cellular response to xenobiotic stimulus; negative regulation of MAPK cascade; and regulation of protein stability. Located in membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
