Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FNDC5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 113-212 of human FNDC5 (NP_715637.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FNDC5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 113-212 of human FNDC5 (NP_715637.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08370A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FNDC5 |
| Target Synonyms | FRCP2; irisin; FNDC5 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 113-212 of human FNDC5 (NP_715637.2?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI | Uniprot ID | Q8NAU1 |
Uniprot Id
Q8NAU1
Target Species
Human
Target Name
FNDC5
Target Full Name
Fibronectin type III domain-containing protein 5
Target Function
Contrary to mouse, may not be involved in the beneficial effects of muscular exercise, nor in the induction of browning of human white adipose tissue.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Peroxisome membrane; Single-pass type I membrane protein.; [Irisin]: Secreted.
Target Tissue Specificity
Widely expressed, with highest levels in heart. Very low expression, if any, in colon, pancreas and spleen.
Target Research Area
Cell Biology
Target Synonyms
Fibronectin type III domain containing 5; Fibronectin type III domain-containing protein 5; Fibronectin type III repeat containing protein 2; Fibronectin type III repeat-containing protein 2; FNDC 5; Fndc5; FNDC5_HUMAN; FRCP2; irisin
Target Background
This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is conserved as an AUG start codon in other organisms. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
