-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRELID1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 174-219 of human PRELID1(NP_037369.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against PRELID1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 174-219 of human PRELID1(NP_037369.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08411A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRELID1 |
| Target Synonyms | PX19; PRELI; SBBI12; CGI-106 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 174-219 of human PRELID1(NP_037369.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSKTLVETAKEAKEKAKETALAATEKAKDLASKAATKKQQQQQQFV | Uniprot ID | Q9Y255 |
Uniprot Id
Q9Y255
Target Species
Human
Target Name
PRELID1
Target Full Name
PRELI domain-containing protein 1, mitochondrial
Target Function
Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Regulates the mitochondrial apoptotic pathway in primary Th cells. Regulates Th cell differentiation by down-regulating STAT6 thereby reducing IL-4-induced Th2 cell number. May be important for the development of vital and immunocompetent organs.
Target Subcellular Location
Mitochondrion. Mitochondrion intermembrane space.
Target Tissue Specificity
Highly expressed in fetal liver; less expressed in fetal brain, lung, and kidney. At the adult stage, expression is drastically reduced in the liver but highly expressed in the spleen, brain, lung, lymph nodes and peripheral blood leukocytes.
Target Research Area
Metabolism
Target Synonyms
25 kDa protein of relevant evolutionary and lymphoid interest; CGI 106; MGC87972; mitochondrial; PRELI; PRELI domain containing 1; PRELI domain containing protein 1; PRELI domain containing protein 1 mitochondrial; PRELI domain-containing protein 1; PRELID 1; PRELID1; PRLD1_HUMAN; Protein of relevant evolutionary and lymphoid interest; PX 19; PX19; Px19 like protein; Px19, chicken, homolog of; Px19-like protein; SBBI12
Target Background
This gene encodes a member of the late embryogenesis abundant motif-containing protein family. The encoded protein is localized to mitochondria and may function as a cytoprotectant by regulating cell death and differentiation. Alternative splicing results in multiple transcript variants encoding different isoforms. Several related pseudogenes have been identified.
Notification