-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STAT6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 748-847 of human STAT6(NP_003144.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against STAT6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 748-847 of human STAT6(NP_003144.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08425A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STAT6 |
| Target Synonyms | STAT6; D12S1644; IL-4-STAT; STAT6B; STAT6C; signal transducer and activator of transcription 6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, U-251 MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 748-847 of human STAT6(NP_003144.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW | Uniprot ID | P42226 |
Uniprot Id
P42226
Target Species
Human
Target Name
STAT6
Target Full Name
Signal transducer and activator of transcription 6
Target Function
Carries out a dual signal transduction and activation of transcription. Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Translocated into the nucleus in response to phosphorylation.
Target Protein Families
Transcription factor STAT family
Target Synonyms
12S1644; D12S1644; IL 4 STAT; IL-4 Stat; IL4 STAT; Interleukin 4 Induced; Interleukin 4 Induced Transcription Factor IL4 STAT; Signal transducer and activator of transcription 6; Signal Transducer And Activator Of Transcription 6 Interleukin 4 Induced; Signal Transducer And Activator Of Transcription 6 Nirs Variant 1; Signal transducer and activator of transcription 6, interleukin 4 induced; STAT 6; STAT interleukin4 induced; STAT, interleukin4 induced; Stat6; STAT6_HUMAN; STAT6B; STAT6C; Transcription factor IL 4 STAT
Target Background
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants.
Notification