Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNRPD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human SNRPD2 (NP_004588.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SNRPD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human SNRPD2 (NP_004588.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08606A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNRPD2 |
| Target Synonyms | SMD2; Sm-D2; SNRPD1; SNRPD2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, HepG2, HL-60, Jurkat, MCF7, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human SNRPD2 (NP_004588.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK | Uniprot ID | P62316 |
Uniprot Id
P62316
Target Species
Human
Target Name
SNRPD2
Target Full Name
Small nuclear ribonucleoprotein Sm D2
Target Function
Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus.
Target Protein Families
SnRNP core protein family
Target Research Area
Transcription
Target Synonyms
Sm-D2; small nuclear ribonucleoprotein D2; Small nuclear ribonucleoprotein D2 (RCG54604); small nuclear ribonucleoprotein D2 polypeptide (16.5kD); small nuclear ribonucleoprotein D2 polypeptide 16.5kDa; SMALL NUCLEAR RIBONUCLEOPROTEIN POLYPEPTIDE D2, SNRPD2; Small nuclear ribonucleoprotein Sm D2; SMD2; SMD2_HUMAN; snRNP core protein D2; SNRPD1; Snrpd2; SNRPD2 small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
Target Background
The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
